PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK22905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 401aa    MW: 45290.6 Da    PI: 8.3357
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK22905.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS330.63e-101384002374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 ++L+++Ae + +g+++ aq +Larl+++ sp g+p++R+a+yf+eAL+  ++++ ++  +++pp+  s+ +++ ++ a+k+fse+sP+++f ++t Nqa
  PK22905.1  38 LDQLYKAAELIGTGNFTHAQGILARLNHQLSPVGKPLHRAAFYFKEALNLLILNNNNNNNNTIPPKCPSPFDVIFKMGAYKVFSEISPLIQFVNFTSNQA 137
                679************************************************************************************************* PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp.gE 200
                +lea+++++r+Hi+Dfdi+ G+QW++++q+L  R++gppsl+iT+++sp++++  el  ++++La+fA+e+gv fe +v+  ++le+ ++++  ++  gE
  PK22905.1 138 LLEALDSADRIHIVDFDIGFGAQWASFMQELPVRNRGPPSLKITAFASPSTHHPVELALMRDNLAQFANEIGVAFELEVVNFDSLEQTSYSMPFFRDqGE 237
                ********************************************************************************999*****9999777667** PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                ++aVn+ +   +  +++++l++    +L++vk+lsPk+vv  ++ +d+++ +F +++l+al+ y  l++sl+a    +s++ +k+E++ll+++i++ v  
  PK22905.1 238 VVAVNFPI--WSASNQPAALPN----LLRFVKQLSPKIVVSLDRGCDRSDLPFPQHILQALHSYINLLESLDAV-NVASDAVNKIEKFLLQPKIESSVLG 330
                ******99..556667999999....*********************************************665.56999******************99 PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                + ++      ++  W+  + +aG++pv++s+++++qa++++++++++g++v+++++sl l+W++r+L+svSaWr
  PK22905.1 331 RLRA----PDKMPLWKTLFASAGYTPVTFSNFTETQAECVVKRTPVRGFHVDKRQASLSLYWQRRELISVSAWR 400
                9988....999**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.04811380IPR005202Transcription factor GRAS
PfamPF035141.0E-9838400IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
XQFLPQQKPL MQKVVLENNN QQQQQQQQQL QQHQHALLDQ LYKAAELIGT GNFTHAQGIL  60
ARLNHQLSPV GKPLHRAAFY FKEALNLLIL NNNNNNNNTI PPKCPSPFDV IFKMGAYKVF  120
SEISPLIQFV NFTSNQALLE ALDSADRIHI VDFDIGFGAQ WASFMQELPV RNRGPPSLKI  180
TAFASPSTHH PVELALMRDN LAQFANEIGV AFELEVVNFD SLEQTSYSMP FFRDQGEVVA  240
VNFPIWSASN QPAALPNLLR FVKQLSPKIV VSLDRGCDRS DLPFPQHILQ ALHSYINLLE  300
SLDAVNVASD AVNKIEKFLL QPKIESSVLG RLRAPDKMPL WKTLFASAGY TPVTFSNFTE  360
TQAECVVKRT PVRGFHVDKR QASLSLYWQR RELISVSAWR C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-335640022375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818601e-52LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132601e-52LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008238556.10.0PREDICTED: scarecrow-like protein 27
SwissprotO813161e-128SCL6_ARATH; Scarecrow-like protein 6
TrEMBLM5WE330.0M5WE33_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s11020.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132692130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-124GRAS family protein